General Information

  • ID:  hor005723
  • Uniprot ID:  P07808
  • Protein name:  Neuropeptide Y
  • Gene name:  Npy
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NPY family
  • Source:  animal
  • Expression:  One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0002865 negative regulation of acute inflammatory response to antigenic stimulus; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior; GO:0008217 regulation of blood pressure; GO:0008284 positive regulation of cell population proliferation; GO:0008343 adult feeding behavior; GO:0010811 positive regulation of cell-substrate adhesion; GO:0021954 central nervous system neuron development; GO:0021987 cerebral cortex development; GO:0031175 neuron projection development; GO:0032100 positive regulation of appetite; GO:0032903 regulation of nerve growth factor production; GO:0042117 monocyte activation; GO:0045776 negative regulation of blood pressure; GO:0045964 positive regulation of dopamine metabolic process; GO:0048572 short-day photoperiodism; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0099509 regulation of presynaptic cytosolic calcium ion concentration; GO:0099538 synaptic signaling via neuropeptide; GO:1904000 positive regulation of eating behavior; GO:1904407 positive regulation of nitric oxide metabolic process; GO:2000300 regulation of synaptic vesicle exocytosis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0031410 cytoplasmic vesicle; GO:0043195 terminal bouton; GO:0043204 perikaryon; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
  • Signal peptide:  MMLGNKRMGLCGLTLALSLLVCLGILAEG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npy1r
  • Target Unid:  P21555
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~ 20 (20-28) minutes; /1200 seconds ( PubMed ID: 3601235 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07808-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005723_AF2.pdbhor005723_ESM.pdb

Physical Information

Mass: 489718 Formula: C189H284N54O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -119.44 Boman Index: -10835
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.44
Instability Index: 6373.89 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  3413293##3601235
  • Title:  Isolation and sequence of rat peptide YY and neuropeptide Y.